PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Oropetium_20150105_24156A
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Cynodonteae; Tripogoninae; Oropetium
Family MYB
Protein Properties Length: 144aa    MW: 15402.4 Da    PI: 8.6165
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Oropetium_20150105_24156AgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding45.22.2e-141760144
                               TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHH CS
            Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrw 44
                               +g W++eEde+lv +  + G g+W+ +ar  g+ R++k+c++rw
  Oropetium_20150105_24156A 17 KGLWSPEEDEKLVAYMLRSGQGSWSDVARNAGLQRCGKSCRLRW 60
                               678***************************************** PP

2Myb_DNA-binding25.43.4e-0859812346
                               -HHHHHHHHTTTS-HHHHHHHHHH CS
            Myb_DNA-binding 23 tWktIartmgkgRtlkqcksrwqk 46
                               +W+ Ia++++ gRt++++k++w++
  Oropetium_20150105_24156A 59 RWSQIAARLP-GRTDNEIKNFWNS 81
                               4*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129418.2691268IPR017930Myb domain
Gene3DG3DSA:1.10.10.606.3E-171360IPR009057Homeodomain-like
SuperFamilySSF466896.94E-171479IPR009057Homeodomain-like
SMARTSM007173.2E-111685IPR001005SANT/Myb domain
PfamPF002492.8E-121760IPR001005SANT/Myb domain
CDDcd001671.32E-92080No hitNo description
Gene3DG3DSA:1.10.10.601.6E-116188IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 144 aa     Download sequence    Send to blast
MRKPAECPPA NMPKLRKGLW SPEEDEKLVA YMLRSGQGSW SDVARNAGLQ RCGKSCRLRW  60
SQIAARLPGR TDNEIKNFWN STIKKRLKNC SAASSPAATT TECASPPLES NNNKLAGGLD  120
DVSAAAAASC PDLAGLDHDG IDF*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankFP0952223e-63FP095222.1 Phyllostachys edulis cDNA clone: bphyem201h24, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002443268.12e-54hypothetical protein SORBIDRAFT_08g016620
SwissprotQ9LXV23e-38MYB46_ARATH; Transcription factor MYB46
TrEMBLC5YP752e-54C5YP75_SORBI; Putative uncharacterized protein Sb08g016620
STRINGSb08g016620.16e-54(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP98213545
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G12870.12e-38myb domain protein 46